If you have been reading about area percent and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-02-26. Numbers and descriptions here follow the published literature rather than marketing material.
Handling and storage influence measured purity, and peptides can oxidize, deamidate, aggregate, or adsorb to surfaces over time. Lyophilized powders stored at -20 °C or lower are generally more stable than solutions, though some sequences require different conditions. Repeated freeze-thaw cycles can promote aggregation and loss, so testing after storage checks whether purity has changed. Stability-indicating methods compare stressed and unstressed samples to detect degradation pathways. Light exposure and pH can also accelerate modification.
Solid-phase peptide synthesis can produce truncated sequences when coupling reactions fail. Deletion peptides lack one or more internal residues, while truncation peptides end prematurely. Side reactions include aspartimide formation, oxidation of methionine, and aggregation during chain assembly. Crude synthetic peptides therefore contain target peptide plus related impurities, counterions, residual solvents, and water. Purification by preparative chromatography reduces these impurities but does not remove every closely related species, including some that differ by a single amino acid.
Quality control specifications for peptides typically include appearance, identity, purity by RP-HPLC, water content, counterion content, and residual trifluoroacetic acid. Karl Fischer titration measures water, while ion chromatography or elemental analysis can quantify counterions. Purity specifications may be set at 95% or 98% area percent, but the appropriate threshold depends on the application. For research reagents, a lower purity may be acceptable if identity is confirmed. For assays sensitive to impurities, higher purity and orthogonal testing are often required.
Orthogonal separation methods address impurities that RP-HPLC may not resolve. Size-exclusion chromatography detects aggregates and higher-order species, while ion-exchange chromatography separates charge variants. Capillary electrophoresis can assess charge-to-mass ratios and, in some formats, size-based impurities. Amino acid analysis and nitrogen determination estimate peptide content rather than chromatographic purity. Because each technique has a different selectivity, a complete purity profile usually combines results from more than one method. The choice of method depends on the impurity classes of concern.
Reversed-phase high-performance liquid chromatography (RP-HPLC) is widely used to estimate peptide purity. Separation depends on interactions between peptide residues and a hydrophobic stationary phase, with gradients of water and organic solvent. Ultraviolet detection near 214 nm responds to the peptide backbone and to many related impurities. The resulting chromatogram is often expressed as area percent, which reports the proportion of peak area assigned to the main component. Different columns, gradients, and wavelengths can produce different purity values for the same material.
Mass spectrometry provides complementary information about molecular identity and certain impurities. Electrospray ionization and matrix-assisted laser desorption/ionization are common ionization techniques for peptides. A measured mass close to the expected value supports correct sequence length and modifications, while extra mass signals can reveal truncations, adducts, or incomplete deprotection. Mass spectrometry alone is not a quantitative purity assay, because ionization efficiency varies between compounds. Coupling liquid chromatography to mass spectrometry links retention time with mass and helps assign peaks that ultraviolet detection records.
| Property | Value | Notes |
|---|---|---|
| Typical purity specification | ≥95% by RP-HPLC | Common for research-grade material; some assays require 98% or higher. |
| Water content | 5–10% w/w | Lyophilized peptides retain moisture; Karl Fischer titration measures it. |
| Counterion | Trifluoroacetate or acetate | Counterion identity affects mass balance and assay compatibility. |
| Storage temperature | -20 °C or lower | Store desiccated and protected from light; avoid repeated freeze-thaw. |
| Common impurity | Deletion or truncation peptide | Similar sequence complicates chromatographic separation. |
Handling practices strongly affect measured purity and sample integrity. Many peptides are hygroscopic, susceptible to oxidation, or prone to adsorption on glass and plastic surfaces. Lyophilized powders are typically stored desiccated at -20 °C or below, while solutions may require colder storage and minimized freeze-thaw cycles. Peptides containing cysteine, methionine, or tryptophan can degrade through oxidation or disulfide exchange. Working aliquots reduce repeated exposure to moisture and temperature fluctuations during routine analysis.
Purity values do not necessarily predict biological potency. Net peptide content corrects for counterions such as acetate or trifluoroacetate, water, and residual salts. Impurity thresholds for reporting, identification, and qualification are often set according to regulatory guidance, though specific limits depend on the product class and route of administration. Open questions remain about the toxicological relevance of low-level peptide impurities and about how best to compare results across different analytical platforms. A certificate of analysis should state the methods used and the basis for each reported value.
Peptide purity testing sits within a broader quality control framework. Release testing commonly includes appearance, identity, purity, peptide content, counterion content, water content, and residual solvents. Elemental impurities and microbiological attributes may be examined when relevant to the manufacturing route. Pharmacopoeial monographs and general chapters provide methods and acceptance criteria for some peptides, but many research-grade materials are not covered by such standards. Method validation establishes specificity, linearity, accuracy, precision, range, and robustness for each test.
Quality control for peptides involves setting specifications for identity, purity, and counterion content. Batches are tested against these specifications before release. Purity specifications often require a minimum area percentage by high-performance liquid chromatography, such as 95% or 98%, depending on the intended application. Additional tests may include water content, acetate or trifluoroacetate content, and residual solvents. These parameters affect the net peptide content and the accuracy of subsequent laboratory experiments.
Stability testing examines how peptide purity changes over time under defined conditions. Accelerated studies use elevated temperatures and humidity to predict degradation pathways, while long-term studies store samples at recommended temperatures. Common degradation reactions include oxidation of methionine, deamidation of asparagine, and hydrolysis of peptide bonds. The results inform expiration dates and storage recommendations for research materials. Lyophilized peptides are generally more stable than solutions, but both forms can degrade if exposed to moisture, oxygen, or repeated freeze-thaw cycles.
Peptide purity testing uses separation methods to estimate the proportion of a sample that corresponds to the target sequence. Reverse-phase high-performance liquid chromatography is the most common technique, separating peptides by hydrophobicity on a nonpolar column. Ultraviolet detection at 214 nm records peptide bonds and aromatic residues. The resulting chromatogram is reported as area percent, which reflects relative absorbance rather than absolute mass. This distinction matters because water, counterions, and residual solvents do not appear in the peptide peak.
Mass spectrometry provides an identity check that complements chromatographic purity. Electrospray ionization or matrix-assisted laser desorption/ionization measures the mass-to-charge ratio of intact peptides. A match to the expected molecular mass supports correct sequence length and terminal groups. Mass accuracy alone does not prove that every peak in a liquid chromatogram is the target peptide. It also does not directly quantify how much water or counterion remains in a lyophilized powder.
Orthogonal methods reduce the chance that a single technique misses an impurity. Capillary electrophoresis separates by charge-to-size ratio and can resolve variants that co-elute under one set of HPLC conditions. Amino acid analysis reports composition after hydrolysis and confirms the presence of expected residues. Karl Fischer titration measures water content, while ion chromatography can quantify counterions. No single number captures all aspects of sample quality, so reports often combine several measurements.
Quality control for peptides begins with a documented specification that states the required purity, identity, and appearance. Suppliers often release research-grade material at 95% or greater by HPLC area, but this threshold is not universal. A certificate of analysis typically records the lot number, sequence, test methods, and measured values. The document allows a user to compare batches and to trace deviations. Specifications should match the intended use rather than a generic label.
Storage and handling conditions affect both peptide stability and the accuracy of later purity tests. Lyophilized powders are commonly kept desiccated at -20 °C or below, while reconstituted solutions require a defined buffer, pH, and temperature range. Repeated freeze-thaw cycles can promote aggregation, oxidation, or hydrolysis over time. Each cycle may alter the chromatogram and complicate comparison with earlier results. Stability data, when available, should guide handling intervals and solvent choice.
Casokinins and lactokinins, breakdown products of casein and whey, occur naturally after ingestion of milk products, especially cultured milk. Their role in blood pressure control is uncertain. The lactotripeptides Val-Pro-Pro and Ile-Pro-Pro produced by the probiotic Lactobacillus helveticus or derived from casein have been shown to have ACE-inhibiting and antihypertensive functions. In one study, L. helveticus PR4 was isolated from Italian cheeses.
Leukolike vectors are a type of nanoparticles made of nanoporous silicon encapsulated by extracted native leukocyte membranes. These particles were among the first artificial white blood cells to be studied as a proof of concept of using cellular membranes to prolong circulation of nanoparticles throughout the blood. Studies have shown that leukolike vectors have a specific advantage in chemotherapy drug delivery to cancer. This is because leukolike vectors specifically have the potential to bind to tumor endothelium.
From Greek βίος (bíos) 'life', (from Proto-Indo-European root *gwei-, to live) and λογία (logia) 'study of'. The compound appears in the title of Volume 3 of Michael Christoph Hanow's Philosophiae naturalis sive physicae dogmaticae: Geologia, biologia, phytologia generalis et dendrologia, published in 1766. The term biology in its modern sense appears to have been introduced independently by Thomas Beddoes (in 1799), Karl Friedrich Burdach (in 1800), Gottfried Reinhold Treviranus (Biologie oder Philosophie der lebenden Natur, 1802) and Jean-Baptiste Lamarck (Hydrogéologie, 1802).
There are three amino acids with side chains that are cations at neutral pH: arginine (Arg, R), lysine (Lys, K) and histidine (His, H). Arginine has a charged guanidino group and lysine a charged alkyl amino group, and are fully protonated at pH 7. Histidine's imidazole group has a pKa of 6.0, and is only around 10% protonated at neutral pH. Because histidine is easily found in its basic and conjugate acid forms it often participates in catalytic proton transfers in enzyme reactions.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Degradation of an amino acid often begins with transamination, in which its amino group is transferred to α-ketoglutarate, forming glutamate. This process involves transaminases, often the same enzymes used in amino acid synthesis. In many vertebrates, the amino group is subsequently released as ammonia and converted to urea via the urea cycle for excretion. However, amino acid degradation can result in uric acid or ammonia instead, depending on the organism. For example, serine dehydratase converts serine directly to pyruvate and ammonia. After removal of one or more amino groups, the remaining carbon skeleton of an amino acid can serve as a precursor for synthesizing other amino acids, be further metabolized for energy after conversion into intermediates of glycolysis (typically via gluconeogenesis) or of the citric acid cycle, or be used for fatty acid synthesis and storage as triacylglycerol. Amino acids are bidentate ligands, forming transition metal amino acid complexes.
While juxtaposed against free-radical polymerization, the application of automated synthesis can be utilized for controlled radical polymerization too. These methods have been used within reversible addition-fragmentation transfer (RAFT), atom-transfer radical (ATRP), and nitroxide-mediated polymerizations, demonstrating the ability of robots to improve efficiency and reduce the hardship of performing reactions. For example, with the automatic dispensation of reagents, Symyx Technologies Inc. was able to polymerize styrene and butyl acrylate through ATRP. In addition, this functionality was supported by Zhang et al. within their research, finding that reproducibility and comparability were equivalent to classical ATRP.
Another common example is the reaction of a primary amine or secondary amine with a carboxylic acid or with a carboxylic acid derivative to form an amide. This reaction is widely used, especially in the synthesis of peptides. On the simple addition of an amine to a carboxylic acid, a salt of the organic acid and base is obtained. To overcome this, the carboxylic acid first needs to be "activated". This is usually done by converting the acid into a more reactive derivative (i.e. anhydride, acid halide) or by using a coupling agent. In some cases, high temperatures (>200 °C) can overcome salt formation by driving off water, without the need for "activation" of the carboxyl group. The downside to this simple reaction is that the compounds may decompose at these elevated temperatures. The carboxylic acid derivatives can be esters, anhydrides, acid halides or any other activated species. The choice of activated carboxyl group or coupling agent can be very important in peptide synthesis, as using the wrong one can lead to racemization.
Anne S. Ulrich (born December 31, 1966) is a German chemist. She is the director of the Institute of Biological Interfaces (IBG-2) and Chair of Biochemistry at the Karlsruhe Institute of Technology. She studied chemistry at the University of Oxford - continued her doctoral work in the laboratory of Anthony Watts - held subsequent research positions as an EMBO-Fellow with Hartmut Oschkinat at the European Molecular Biology Laboratory in Heidelberg and as a Liebig-Fellow with Felix Wieland at the University of Heidelberg - became Associate Professor at the University of Jena - until she moved her group in 2002 to the Karlsruhe Institute of Technology. Her research focuses on the structural and functional analysis of biomembranes by solid state NMR. The main systems of interest are:
Sources: en.wikipedia.org
An aviation accident is an event during aircraft operation that results in serious injury, death, or significant destruction. An aviation incident is any operating event that compromises safety but does not escalate into an aviation accident. Preventing both accidents and incidents is the primary goal of aviation safety. The most common causes of these accidents and incidents are technical or mechanical failures of the aircraft and pilot error. Adverse weather conditions, including turbulence, thunderstorms, icing, and low visibility, have also historically been major contributing factors in aviation accidents and incidents worldwide. Since civil aviation became widespread in the mid-20th century, hundreds of incidents have occurred every year, with most being minor and non-fatal.
Following subcutaneous injection, albiglutide reaches highest blood concentrations after three to five days. Steady-state concentrations are achieved after three to five weeks. The substance is most likely broken down by protease enzymes to small peptides and amino acids. Being resistant to dipeptidyl peptidase-4 (DPP-4), the enzyme that breaks down GLP-1, albiglutide has a biological half-life of five (4–7) days, which is considerably longer than the older GLP-1 analogs exenatide and liraglutide. This allows for a once-weekly administration, unlike liraglutide but like the extended-release form of exenatide. Albiglutide is a peptide consisting of 645 proteinogenic amino acids with 17 disulfide bridges. Amino acids 1–30 and 31–60 constitute two copies of modified human GLP-1, the alanine at position 2 having been exchanged for a glycine for better DPP-4 resistance. The remaining sequence is human albumin. The complete sequence is
Not much is known about the mutations in the genes OBS1and CCD8 and their function in growth and development so far. However, the implications of 3M syndrome suggest that both these genes encode for proteins that play a role in the CUL7 ubiquination pathway. Due to the fact that many of the abnormalities associated with this disorder are congenital, the presence of these clinical features at birth is usually sufficient to make the diagnosis. Diagnosis is suggested in children with the following: low birth weight, severe growth retardation, typical facial features, and characteristic radiological findings. In some cases, growth retardation and/or other characteristic findings suggestive of Three M syndrome may be detected before birth by ultrasound. In fetal ultrasonography, reflected sound waves are used to create an image of the developing fetus.
Sources: en.wikipedia.org
No. Purity testing measures chemical composition and does not assess biological activity, sterility, or endotoxin levels. Functional performance must be tested in the intended assay.
Water adds mass and can affect concentration calculations. A peptide labeled 95% pure may contain water and counterions that reduce the actual peptide content.
Identity can be checked by mass spectrometry, and purity by RP-HPLC. Store according to supplier instructions and retest if experimental performance changes.
RP-HPLC purity is the relative area of the main peptide peak compared with the total integrated peak area. It reflects ultraviolet-absorbing species under one set of separation conditions. It does not identify every impurity or measure biological activity.