stability study raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-01-03 and is reviewed periodically as new material appears.
Stability testing examines how peptide purity changes over time under defined conditions. Accelerated studies use elevated temperatures and humidity to predict degradation pathways, while long-term studies store samples at recommended temperatures. Common degradation reactions include oxidation of methionine, deamidation of asparagine, and hydrolysis of peptide bonds. The results inform expiration dates and storage recommendations for research materials. Lyophilized peptides are generally more stable than solutions, but both forms can degrade if exposed to moisture, oxygen, or repeated freeze-thaw cycles.
Impurity profiling identifies and quantifies substances that coexist with the target peptide. These include deletion sequences, truncated peptides, oxidized variants, and residual protecting groups from synthesis. Reversed-phase chromatography can separate many of these impurities, but co-elution remains a challenge for closely related species. Mass spectrometry helps assign identities to impurity peaks, and impurity limits are often set as area percentages relative to the main peak. Regulatory guidelines for research-grade peptides are less strict than those for therapeutic products, so specifications vary by supplier.
Quality control for peptides involves setting specifications for identity, purity, and counterion content. Batches are tested against these specifications before release. Purity specifications often require a minimum area percentage by high-performance liquid chromatography, such as 95% or 98%, depending on the intended application. Additional tests may include water content, acetate or trifluoroacetate content, and residual solvents. These parameters affect the net peptide content and the accuracy of subsequent laboratory experiments.
Orthogonal methods reduce the chance that a single technique misses an impurity. Capillary electrophoresis separates by charge-to-size ratio and can resolve variants that co-elute under one set of HPLC conditions. Amino acid analysis reports composition after hydrolysis and confirms the presence of expected residues. Karl Fischer titration measures water content, while ion chromatography can quantify counterions. No single number captures all aspects of sample quality, so reports often combine several measurements.
Peptide purity testing uses separation methods to estimate the proportion of a sample that corresponds to the target sequence. Reverse-phase high-performance liquid chromatography is the most common technique, separating peptides by hydrophobicity on a nonpolar column. Ultraviolet detection at 214 nm records peptide bonds and aromatic residues. The resulting chromatogram is reported as area percent, which reflects relative absorbance rather than absolute mass. This distinction matters because water, counterions, and residual solvents do not appear in the peptide peak.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature (lyophilized) | -20 °C | Long-term storage; -80 °C for extended periods |
| Typical storage temperature (solution) | -80 °C | Avoid repeated freeze-thaw; aliquot before freezing |
| Common degradation pathway | Oxidation of methionine | Affects peptides containing methionine; accelerated by oxygen |
| Common counterion | Trifluoroacetate | From HPLC purification; acetate also common |
| Purity specification (research grade) | ≥95% by HPLC area | Higher grades may require ≥98%; method-dependent |
Independent verification is used when a supplier result needs confirmation or when a material supports regulated work. A second laboratory can repeat reverse-phase HPLC and mass spectrometry on the same sample. Discrepancies may arise from different columns, gradients, detection wavelengths, or sample preparation. Moisture uptake and counterion content can lower net peptide mass without changing area percent. Documentation of methods and raw data helps distinguish analytical variation from a true quality difference.
Quality control for peptides begins with a documented specification that states the required purity, identity, and appearance. Suppliers often release research-grade material at 95% or greater by HPLC area, but this threshold is not universal. A certificate of analysis typically records the lot number, sequence, test methods, and measured values. The document allows a user to compare batches and to trace deviations. Specifications should match the intended use rather than a generic label.
Storage conditions influence purity and therefore testing outcomes. Lyophilized peptides are generally kept cool and dry, while solutions may require refrigeration or freezing depending on sequence and buffer. Repeated freeze-thaw cycles can promote aggregation, oxidation, or hydrolysis. Testing after storage should use the same validated method as release testing to allow comparison. Stability studies examine how purity changes over time under defined temperature and humidity conditions. Results are compared against baseline data collected at release.
Regulatory frameworks treat peptide purity as part of product quality, though requirements vary by intended use and jurisdiction. Investigational materials may need identity, strength, quality, and purity documentation. Compendial monographs, when available, specify tests and acceptance criteria for certain peptides. For research peptides, oversight is often less prescriptive, and buyers may rely on supplier documentation. Open questions remain about how to standardize impurity reporting across laboratories and how to define purity for complex or modified peptides.
Quality control for peptide products relies on written procedures, batch records, and certificates of analysis. A certificate of analysis typically lists the test methods, specifications, and results for a specific lot. Batch records document synthesis, purification, and testing steps so that results can be traced to process conditions. Method validation establishes accuracy, precision, specificity, linearity, and limits of detection. These records support consistency across lots and allow laboratories to investigate deviations when a specification is not met.
Reverse-phase high-performance liquid chromatography (RP-HPLC) is widely used to estimate peptide purity. It separates components by hydrophobicity on a column with a water-organic mobile phase. Ultraviolet absorbance at 214 nm or 220 nm detects peptide bonds. The main peak area as a percentage of total peak area gives a purity figure. This figure depends on column, gradient, wavelength, and how peaks are integrated, so it is method-specific rather than absolute.
Mass spectrometry provides complementary information by measuring molecular mass. Electrospray ionization or matrix-assisted laser desorption/ionization can confirm the expected peptide mass and reveal related impurities with different masses. It does not directly quantify all species because ionization efficiency varies. When coupled to liquid chromatography, LC-MS can assign masses to chromatographic peaks. This helps distinguish target peptide from truncation, oxidation, or deletion products. Mass accuracy and resolution determine how confidently a mass can be matched to a proposed structure.
Purity results are only meaningful when linked to a defined sample and method. A certificate of analysis typically lists the analytical technique, column type, gradient, detection wavelength, and integration parameters. It may also report mass confirmation, water content, and counterion composition. For research peptides, laboratories often request the raw chromatogram rather than only a summary percentage. This allows independent review of baseline, peak shape, and any unresolved shoulders that might be missed by a single number.
Stability testing examines how purity changes under controlled conditions. Samples are stored at defined temperatures, such as -20 °C or -80 °C, and analyzed at intervals. Lyophilized powders are generally more stable than solutions because water promotes hydrolysis and aggregation. Repeated freeze-thaw cycles can also degrade peptides, especially those with oxidation-prone residues. Accelerated studies at elevated temperature provide useful comparisons, but they do not always predict long-term behavior at lower temperatures.
Handling practices influence measured purity. Peptides may adsorb to plastic or glass surfaces, particularly when hydrophobic or positively charged. Weighing hygroscopic powders can introduce water and alter concentration. Dissolving in appropriate solvents and using low-binding tubes can reduce losses. Each laboratory should validate its own procedures because recovery and stability vary with peptide sequence, formulation, and container material. Open questions remain about how best to standardize stability reporting across different peptide classes.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Molecular biomarkers have been defined as biomarkers that can be discovered using basic and acceptable platforms such as genomics and proteomics. Many genomic and proteomics techniques are available for biomarker discovery and a few techniques that are recently being used can be found on that page. Apart from genomics and proteomics platforms biomarker assay techniques, metabolomics, lipidomics, glycomics, and secretomics are the most commonly used as techniques in identification of biomarkers. Biomarkers can be classified on their clinical applications as molecular biomarkers, cellular biomarkers or imaging biomarkers. Four of the main types of molecular biomarkers are genomic biomarkers, transcriptomic biomarkers, proteomic biomarkers and metabolic biomarkers.
Autosomal-dominant mutations in APP cause hereditary early-onset Alzheimer's disease (familial AD, fAD). This form of AD accounts for no more than 10% of all cases, and the vast majority of AD is not accompanied by such mutations. However, familial Alzheimer's disease is likely to result from altered proteolytic processing. This is evidenced by the fact that many mutations that lead to fAD occur near γ-secretase cleavage sites on APP. One of the most common mutations causing fAD, London Mutation, occurs at codon 717 of the APP gene, and results in a valine to isoleucine amino acid substitution. Histochemical analysis of the APP V717I mutation has revealed extensive Aβ pathology throughout neuroaxis as well as widespread cerebral amyloid angiopathy (CAA). The gene for the amyloid precursor protein is located on chromosome 21, and accordingly people with Down syndrome have a very high incidence of Alzheimer's disease.
Cotadutide is an experimental drug for the treatment of type 2 diabetes mellitus. It lowers blood glucose levels by mimicking the human hormones glucagon-like peptide 1 and glucagon, which play a role in blood sugar regulation. The drug is a peptide that is injected under the skin. Cotadutide is in Phase II clinical trials as of February 2021. Cotadutide, a therapeutic agent, was undergoing Phase II clinical trials. This stage of trials typically involves evaluating the drug's effectiveness and further assessing its safety in a larger group of participants, compared to earlier phases. Glucagon (medication)
Topical nonsteroidal anti-inflammatory drugs provide pain relief in common conditions such as muscle sprains and overuse injuries. Since the side effects are also lesser, topical preparations could be preferred over oral medications in these conditions. Some novel and investigational analgesics include subtype-selective voltage-gated sodium channel blockers such as funapide and raxatrigine, as well as multimodal agents such as ralfinamide. Audioanalgesia Electroanalgesia Pain management Patient-controlled analgesia Pain in babies Congenital analgesia (insensitivity to pain)
Sources: en.wikipedia.org
Arabinogalactan-proteins (AGPs) are highly glycosylated proteins (glycoproteins) found in the cell walls of plants. Each one consists of a protein with sugar molecules attached (which can account for more than 90% of the total mass). They are members of the wider class of hydroxyproline (Hyp)-rich cell wall glycoproteins, a large and diverse group of glycosylated wall proteins. AGPs have been reported in a wide range of higher plants in seeds, roots, stems, leaves and inflorescences. AGPs account for only a small portion of the cell wall, usually no more than 1% of dry mass of the primary wall. They have also been reported in secretions of cell culture medium of root, leaf, endosperm and embryo tissues, and some exudate producing cell types such as stylar canal cells are capable of producing lavish amounts of AGPs. They are implicated in various aspects of plant growth and development, including root elongation, somatic embryogenesis, hormone responses, xylem differentiation, pollen tube growth and guidance, programmed cell death, cell expansion, salt tolerance, host-pathogen interactions, and cellular signaling. AGPs have attracted considerable attention due to their highly complex structures and potential roles in signalling. In addition, they have industrial and health applications due to their chemical/physical properties (water-holding, adhesion and emulsification).
BIA Separations was formed in 1998 by a group of scientists in Ljubljana, Slovenia to commercialize a new chromatographic resin based on monolith technology. Monolithic resin was developed independently by three different laboratories in late 1980s led by Hjertén, Švec and Tennikova. The company was one of the few Slovenian companies to receive venture capital funding at that time-Horizonte Venture Management realizing the potential of monoliths made the initial investment in the company. During that year, BIA Separations released its first commercial product marketed under the trade name of CIM (Convective Interaction Media). The new technique was named HPMC (High Performance Monolith Chromatography). During the 1999 and 2000s, the company promoted this new platform technology to the scientific and business community and registered several patents. In 2007 the company headquarters moved to Villach, Austria. In 2011 BIA Separations entered a strategic partnership with Japan Synthetic Rubber Corporation, a Japanese company producing synthetic materials. A strategic partnership agreement with Showa Denko K.K. (SDK) was signed in 2012.
Activity-based proteomics, or activity-based protein profiling (ABPP) is a chemoproteomic strategy that employs modular probes to directly assess the functional state of enzymes within complex proteomes. Unlike expression-based proteomics, which measures protein abundance, ABPP provides information about catalytic activity, thereby enabling researchers to distinguish between active and inactive forms of enzymes. This functional perspective has proven valuable for identifying drug targets, mapping ligandable sites, and understanding enzyme regulation in physiological and pathological contexts. By covalently modifying active sites, activity-based probes (ABPs) allow selective tagging, enrichment, and isolation of proteins, reducing the complexity of proteomic samples and facilitating downstream analysis. ABPP has been applied across diverse biological systems, including cells, tissues, and whole organisms, and has contributed to advances in biomarker discovery, drug development, and in vivo imaging.
Chemistry... Key to Better Living. Diamond Jubilee Volume: A Record of Chemical Progress During the First 75 Years of the American Chemical Society. American Chemical Society. 1951. Skolnik, Herman; Reese, Kenneth M., eds. (1976). A Century of chemistry: the role of chemists and the American Chemical Society. Washington, D.C.: American Chemical Society. ISBN 978-0841203075. J. J. Bohning 2001. American Chemical Society Founded 1876. ACS, Washington, D.C. Reese, Kenneth M., ed. (2002). The American Chemical Society at 125: A recent history 1976–2001. American Chemical Society. ISBN 978-0-8412-3851-0. ACS website ACS Publications website ACS Chemical & Engineering News ACS Chemical Abstracts Service (CAS) International Year of Chemistry 2011(archived) A Cauldron Bubbles: PubChem and the American Chemical Society — Information Today, June 2005 ACS Chemical Biology WIKI(archived) ACS Chemical Biology Community(archived) ACS Green Chemistry Institute ACS Organic Division Leete Award Gassman Award
A/B tests are sensitive to variance; they require a large sample size in order to reduce standard error and produce a statistically significant result. In applications in which active users are abundant, such as with popular online social-media platforms, obtaining a large sample size is trivial. In other cases, large sample sizes are obtained by increasing the experiment enrollment period. However, using a technique coined by Microsoft as Controlled Experiment Using Pre-Experiment Data (CUPED), variance from before the experiment start can be taken into account so that fewer samples are required to produce a statistically significant result. Because of its nature as an experiment, running an A/B test introduces the risk of wasted time and resources if the test produces unwanted or unhelpful results. In December 2018, representatives with experience in large-scale A/B testing from 13 organizations (Airbnb, Amazon, Booking.com, Facebook, Google, LinkedIn, Lyft, Microsoft, Netflix, Twitter, Uber and Stanford University) summarized the top challenges in a paper. The challenges were grouped into four areas: analysis, engineering and culture, deviations from traditional A/B tests and data quality.
Sources: en.wikipedia.org
2-Aminoisobutyric acid (Aib) is the non-proteinogenic amino acid with the structural formula H2N-C(CH3)2-COOH. The Aib residue is a component of tirzepatide, a commonly prescribed antidiabetic medication for treatment of type 2 diabetes. Although uncommon, it is also found in some natural products 2-Aminoisobutyric acid can be prepared from acetone cyanohydrin, by reaction with ammonia followed by hydrolysis. The compound is not chiral, unlike most amino acids. It is a strong helix inducer in peptides due to Thorpe–Ingold effect of its gem-dimethyl group. Oligomers of Aib form 310 helices.
June 29 – July 6: 2019 Men's U20 European Lacrosse Championship in Prague (debut event) England defeated Germany, 9–8, to win the inaugural Men's U20 European Lacrosse Championship title. The Czech Republic took third place. July 16 – 25: 2019 Women's European Lacrosse Championship in Netanya England defeated Israel, 10–7, to win their third consecutive and seventh overall Women's European Lacrosse Championship title. Wales took third place. August 1 – 10: 2019 FIL Women's Under-19 World Lacrosse Championships in Peterborough The United States defeated Canada, 13–3, to win their fifth Women's Under-19 World Lacrosse Championships title. Australia took third place. September 19 – 28: 2019 World Indoor Lacrosse Championship in Langley Canada defeated Haudenosaunee, 19–12, to win their fifth consecutive World Indoor Lacrosse Championship title. United States took third place.
Ana María Muñoz Jauregui (born 1969, Lima) is a Peruvian pharmacist, biochemist and nutritionist. She has served as Rector and, since 2023, as the Vice Rector of research at San Ignacio de Loyola University (USIL). Muñoz has authored numerous publications and received national and international awards, such as silver, gold medals and semi-grand prize wins at the International KIWIE Award. Muñoz, was born in Lima, Peru. In 1996, she attended the National University of San Marcos (UNMSM), where she earned her pharmaceutical degree. While studying, she developed an interest in the field of nutrition. She earned a master's degree in biochemistry and nutrition, and earned a PhD in Pharmacy and Biochemistry from the National University of San Marcos (UNMSM) in 2006.
Chattopadhyay's contributions in membrane and receptor biology and biophysics have been recognized by several awards and prizes. These include The World Academy of Sciences (TWAS) Prize, Shanti Swarup Bhatnagar Award, Ranbaxy Research Award, Prof. G.N. Ramachandran Gold Medal, SERB Distinguished Fellowship, Prof. G.N. Ramachandran 60th Birthday Medal and J.C. Bose Fellowship. He is an elected Fellow of The World Academy of Sciences, Royal Society of Biology, Royal Society of Chemistry, and all the Indian Academies of Science. Fellow, The World Academy of Sciences (2017) Fellow, The Royal Society of Biology (2017) Fellow, The Royal Society of Chemistry (2013) Fellow, Indian National Science Academy (2005) Fellow, Indian Academy of Sciences (1999) Fellow, The National Academy of Sciences, India (1998) Fellow, West Bengal Academy of Science & Technology (2010) Fellow, Andhra Pradesh Akademi of Sciences (2003) Fellow, Telangana Academy of Sciences (2015) Google Scholar
Sources: en.wikipedia.org
Lyophilized peptides are typically stored at -20 °C or lower, protected from moisture and light. Solutions are often stored at -80 °C and divided into single-use aliquots. Repeated freeze-thaw cycles should be avoided.
Oxidation of methionine and deamidation of asparagine are frequent reactions. Hydrolysis of peptide bonds can occur under acidic or basic conditions. Each pathway produces impurities that reduce purity.
Specifications depend on the intended use and supplier. Common minimums are 95% or 98% by HPLC area percentage. Identity and counterion content are also checked.
It measures the relative ultraviolet absorbance area of peptide peaks, usually at 214 nm. It does not directly measure mass, water, counterions, or co-eluting species.