Thymosin beta-4 comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-10-20. Where a claim depends on a specific study, the study is described rather than over-claimed.
Sports authorities classify the peptide as a prohibited substance, and it appears on the World Anti-Doping Agency list under peptide hormones, growth factors, and related substances. Racing jurisdictions for horses and dogs have issued separate restrictions, and several national bodies treat it as a controlled or prescription-only item. As a research chemical it is sold without a therapeutic indication, and labels usually state that the product is not for human or veterinary use. Regulatory treatment therefore varies by country.
Detection in biological matrices generally relies on liquid chromatography coupled with tandem mass spectrometry, because the peptide lacks a convenient ultraviolet chromophore beyond the amide backbone. Immunoassays have been described, but antibodies raised against the fragment can cross-react with the full-length protein or with unrelated peptides, so findings usually require confirmation by a second technique. Sample preparation typically involves protein precipitation followed by solid-phase extraction. Reported detection windows depend on dose, route, matrix, and instrument sensitivity.
Lyophilised material is stable for extended periods when kept dry and cold, and suppliers typically recommend storage well below freezing. Once dissolved, the peptide is handled at refrigeration temperatures and used within a short period, because peptide bonds and the acetylated terminus can be affected by repeated freeze-thaw cycles, proteases, or extreme pH. Bacteriostatic water and saline are both described as solvents, although preservatives can interfere with some analytical workflows. Reconstituted solutions are inspected for particulates before use.
Regulatory status differs by country, but TB-500 is not an approved pharmaceutical in major jurisdictions. It is commonly sold as a research chemical for laboratory use, which places responsibility for identity and purity on the supplier and the laboratory. Published human data are limited, and most reports involve preclinical models or cell culture. Questions about whether the fragment mimics all actions of thymosin beta-4, and under which conditions, remain open. Independent verification of any material is therefore a practical requirement in research settings.
TB-500 is a synthetic heptapeptide with the sequence Ac-LKKTETQ. It corresponds to a short N-terminal region of thymosin beta-4, a 43-amino-acid protein found in many cell types. The fragment contains an actin-binding motif, which is one reason it appears in laboratory studies of cell migration and cytoskeletal dynamics. TB-500 is not the full-length protein and is produced as a research chemical rather than an approved therapeutic agent. Its molecular weight is approximately 889 Da.
Several names appear in scientific and commercial contexts for this peptide. The label TB-500 is informal and does not follow standard biochemical nomenclature. Research articles more often describe the compound as a thymosin beta-4 fragment, Tβ4 fragment, or by its sequence Ac-LKKTETQ. Confusing TB-500 with full-length thymosin beta-4 can lead to incorrect assumptions about activity because the fragment lacks the remaining residues of the parent protein. The relationship between fragment and parent protein remains an active area of study.
| Property | Value | Notes |
|---|---|---|
| Analytical method | LC-MS/MS | Preferred confirmatory technique |
| Appearance | White to off-white powder | Lyophilised form |
| Solubility | Freely soluble in water | Also described in saline |
| Storage temperature | Below -20 °C for powder | Short-term refrigeration for solutions |
| Regulatory status | Prohibited in sport | Listed under peptide hormones |
Thymosin beta-4 contains 43 amino acids and has a reported molecular mass near 4963 Da. The short fragment most often associated with the TB-500 label, an acetylated chain beginning LKKTETQ, has a reported mass near 889 Da, so the two are easily separated in analytical work. Mass spectrometry and amino acid analysis can confirm which material is present in a given sample. Statements treating TB-500 and thymosin beta-4 as interchangeable are therefore imprecise, even though the two appear together in much of the same literature.
Interest in the compound comes largely from studies of the parent protein, which participates in actin sequestration, cell migration and tissue repair processes. Whether a short fragment reproduces those activities is a separate question that remains open in the published record. Many summaries describe mechanisms by analogy to thymosin beta-4 rather than from direct measurements on the fragment. Claims about activity should be treated as provisional unless a cited study specifies the exact peptide, its purity and the assay used.
TB-500 is a laboratory label applied to a short synthetic peptide that is widely described as a fragment of thymosin beta-4, an actin-binding protein present in most mammalian cells. Suppliers and review articles usually present TB-500 as the N-terminal region of that protein, but the exact sequence attached to the name is not consistent across sources. Some product descriptions list a seven-residue chain; others use the label loosely for the parent protein itself. Because of that variation, any technical discussion of TB-500 needs to state which sequence is meant.
The regulatory position is broadly consistent across major jurisdictions: no thymosin beta-4 fragment is an approved medicine, and laboratory material is commonly labelled as not intended for human consumption. Anti-doping rules in sport list thymosin beta-4 and its fragments among prohibited peptide hormones. Because these products travel through research-chemical channels rather than pharmaceutical supply chains, quality varies considerably between vendors. Independent testing of identity, purity and sterility is the only dependable check, and a certificate of analysis describes one batch rather than a supplier's whole catalogue.
Lyophilized peptide powder is normally held desiccated at −20 °C, with −80 °C used for longer storage periods. Allowing a sealed vial to reach room temperature before opening is standard practice, because condensation forming on cold powder introduces moisture. Once dissolved, solutions are typically kept cold and shielded from light. Repeated freeze-thaw cycles are avoided because they encourage aggregation and gradual loss of material. These conventions are general to synthetic peptides rather than unique to any one sequence.
Controlled human trials of the short fragment are scarce. Much of what appears in review articles is extrapolated from animal models or from studies of the parent protein, and literature searches return a larger body of cardiac and ophthalmic work on thymosin beta-4 than on the abbreviated peptide. Regulatory treatment differs by jurisdiction, and in several countries the material is handled as a research chemical rather than an approved therapeutic. Statements about human benefit should be read as provisional.
Biological interest in this peptide centers on its relationship to actin dynamics. Thymosin beta-4 binds monomeric actin through an LKKTET motif, and a short sequence carrying that motif can compete with other actin-binding proteins in cell-free preparations. Investigators propose that such competition shifts the balance between filament assembly and disassembly, which in turn affects how readily a cell extends protrusions and migrates. Most of the supporting observations come from cultured cells and purified protein systems rather than from intact organisms.
No major regulatory agency has approved TB-500 for therapeutic use, and it holds no pharmacopoeial monograph. The name appears on the World Anti-Doping Agency prohibited list within the class covering peptide hormones, growth factors, and related substances. Detection in doping control relies on mass spectrometric methods applied to urine, often after preparation steps that concentrate the analyte. Discussion of TB-500 therefore clusters in biochemistry, sports medicine, and anti-doping literature rather than in registered clinical trials.
TB-500 is a synthetic peptide preparation marketed under a name derived from thymosin beta-4, a 43-residue actin-binding protein first isolated from thymus tissue. The full-length protein has a reported molecular mass near 4963 Da, while material sold as TB-500 is often described as a fragment containing the actin-binding motif LKKTETQ. Because suppliers use the name inconsistently, published sources sometimes refer to the same label as a fragment, a synthetic copy, or a related analog. This naming ambiguity complicates direct comparison of reports across studies.
Laboratory work on thymosin beta-4 describes binding to monomeric actin and effects on cell migration, angiogenesis, and inflammatory signaling in cultured cells. Animal models have examined skin, corneal, and cardiac repair after injury, with outcomes reported mainly in preclinical literature. Most of that evidence concerns the parent protein rather than preparations labelled TB-500, so extrapolation from animal findings to a specific commercial product remains uncertain. Whether the two behave identically in living systems has not been established in controlled human studies.
Due to its property of being a prodrug of GHB which increases sleep related growth hormone (GH) secretion, GBL was sold as a nutritional supplement after the scheduling of GHB, under the names Revivarant and Renewtrient, until they were banned by the FDA.
In March 1945, he gave key cabinet positions to Czechoslovak communist exiles in Moscow. Especially after the German reprisals for the assassination of Reinhard Heydrich, most of the Czech resistance groups demanded, with eerie irony and based on Nazi terror during the occupation, ethnic cleansing or the "final solution of the German question" (Czech: konečné řešení německé otázky) which would have to be "solved" by deportation of the ethnic Germans from their homeland. These reprisals included massacres in villages Lidice and Ležáky, although these villages were not connected with Czech resistance. These demands were adopted by the government-in-exile, which sought the support of the Allies for this proposal, beginning in 1943. During the occupation of Czechoslovakia, the Government-in-Exile promulgated a series of laws that are now referred to as the "Beneš decrees". One part of these decrees dealt with the status of ethnic Germans and Hungarians in postwar Czechoslovakia, and laid the ground for the deportation of some 3,000,000 Germans and Hungarians from the land that had been their home for centuries (see expulsion of Germans from Czechoslovakia, and Hungarians in Slovakia). The Beneš decrees declared that German property was to be confiscated without compensation. However, the final agreement authorizing the forced population transfer of the Germans was not reached until 2 August 1945 at the end of the Potsdam Conference.
C57BL/6 mice have a dark brown, nearly black coat. They are more sensitive to noise and odours and are more likely to bite than the more docile laboratory strains such as BALB/c. Group-housed C57BL/6 mice (and other strains) display barbering behaviour, which used to be seen as a sign of dominance. However, it is now known that this is more of a stereotypical behaviour triggered by stress, comparable to trichotillomania in humans or feather plucking in parrots. Mice that have been barbered extensively can have large bald patches on their bodies, commonly around the head, snout, and shoulders, although barbering may appear anywhere on the body. Also self-barbering can occur. Both hair and vibrissae may be removed. Barbering is more frequently seen in female mice; male mice are more likely to display dominance through fighting. C57BL/6 has several unusual characteristics which make it useful for some research studies but inappropriate for others: It is unusually sensitive to pain and to cold, and analgesic medications are less effective in this strain. Unlike most laboratory mouse strains, the C57BL/6 drinks alcoholic beverages voluntarily. It is more susceptible than average to morphine addiction, atherosclerosis, and age-related hearing loss. When compared directly to BALB/c mice, C57BL/6 mice also express both a robust response to social rewards and empathy.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Despite his cynical behaviour, he gradually wins over Arun's colleagues. Complications arise when Chandramouli and his brother-in-law, Lovababu, arrive unexpectedly in San Francisco. Though Uma promises to keep the story hidden and lies that he is Arun's childhood friend, Chandramouli, who has been aware of Pallavi's past involvement with someone, secretly tries to find if she is happy with Arun. During a business trip to Santa Monica, Pallavi witnesses Arun hugging another woman, leading her to suspect him of infidelity. Meanwhile, Chandramouli learns through a phone conversation with Arun's father that Arun had no childhood friend called Uma, eventually confirming Uma and Pallavi's past relationship through Pallavi's friend Kavitha. When Pallavi confronts Arun about the woman, his evasive answers increases his suspicion, prompting her to confide in Uma. Believing Pallavi will now leave Arun, Uma is approached by a remorseful Chandramouli, who offers to marry Pallavi to him. Before acting, Uma confronts Arun and discovers that the woman is Christie, a friend from Arun's MBA days in the United States. Christie had developed unrequited feelings for Arun. After he rejected her proposal, she attempted suicide and descended into drug addiction. Guilt-ridden, Arun had been secretly visiting her to support her rehabilitation. Arun reveals to Uma that he agreed to let Uma stay in their house precisely to prevent him from suffering a similar self-destructive path. Realizing Arun's integrity and selflessness, Uma decides to step aside.
Sources: en.wikipedia.org
When cannabis is cultivated for its psychoactive or medicinal properties, male plants will often be separated from females. This prevents fertilization of the female plants, either to facilitate sin semilla flowering or to provide more control over which male is chosen. Pollen produced by the male is caught and stored until it is needed. When a male plant of one strain pollinates a female of another strain, the seeds will be F1 hybrids of the male and female. These offspring will not be identical to their parents. Instead, they will have characteristics of both parents. Repeated breeding results in certain characteristics appearing with greater regularity. It is impossible for a hermaphrodite to create any male-only seeds. A hermaphrodite may create female only seeds and hermaphrodite seeds. Also the female-only seeds may carry the hermaphrodite trait. Hybridization is the process of plants and animals breeding. Natural wind currents help speed up this hybridization process and promotes a positive growth. Some plants produce many seeds while some produce little to none depending on how it is bred. If seeds are produced traits from both the original parents will be expressed. Techniques such as mutation breeding are used to develop new strains using irradiation or chemical mutagens such as colchicine. Various companies have been experimenting with creating new strains using genetic engineering techniques.
fatty acid Any of a subclass of lipid compounds consisting of a carboxylic acid bonded to an aliphatic chain of hydrocarbons, usually 4 to 28 carbon atoms in length, which may be either saturated (containing only single bonds between the carbon atoms) or unsaturated (containing one or more double bonds). In biological systems, fatty acid chains are commonly linked to other compounds via ester bonds, primarily in triglycerides, phospholipids, and derivatives of cholesterol, all of which serve a wide variety of important cellular functions including as structural components of membranes and as energy sources in metabolic pathways.
=== Later years === Nine years before his death, Fox underwent quintuple bypass surgery and was in a coma for 13 weeks. He survived without any major impairment and carried on with his career. Fox continued working as a professor up into his eighties. In 1996, 2 years before his death, Fox was elected Fellow of the International Society for the Study of the Origin of Life or ISSOL. Sidney Walter Fox died on Monday, August 10, 1998, in Mobile, Alabama.
Normally, Hagen–Poiseuille flow implies not just the relation for the pressure drop, above, but also the full solution for the laminar flow profile, which is parabolic. However, the result for the pressure drop can be extended to turbulent flow by inferring an effective turbulent viscosity in the case of turbulent flow, even though the flow profile in turbulent flow is strictly speaking not actually parabolic. In both cases, laminar or turbulent, the pressure drop is related to the stress at the wall, which determines the so-called friction factor. The wall stress can be determined phenomenologically by the Darcy–Weisbach equation in the field of hydraulics, given a relationship for the friction factor in terms of the Reynolds number. In the case of laminar flow, for a circular cross section:
Sources: en.wikipedia.org
The most common approach is liquid chromatography with tandem mass spectrometry after extraction from blood or urine. Immunoassays exist but are generally treated as screening tools because of cross-reactivity.
Dry lyophilised powder is normally kept frozen and protected from moisture and light. Dissolved material is handled cold and used promptly to limit degradation.
It is not licensed as a medicine in major markets and is distributed as a research chemical. Sports organisations prohibit its use, and some countries restrict import and supply.
TB-500 is a synthetic heptapeptide corresponding to a fragment of thymosin beta-4. It is used in laboratory research and is not an approved drug.